Anti HLTF pAb (ATL-HPA015284)

Atlas Antibodies

Catalog No.:
ATL-HPA015284-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: helicase-like transcription factor
Gene Name: HLTF
Alternative Gene Name: HIP116A, HLTF1, RNF80, SMARCA3, SNF2L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002428: 89%, ENSRNOG00000000082: 88%
Entrez Gene ID: 6596
Uniprot ID: Q14527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK
Gene Sequence LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK
Gene ID - Mouse ENSMUSG00000002428
Gene ID - Rat ENSRNOG00000000082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HLTF pAb (ATL-HPA015284)
Datasheet Anti HLTF pAb (ATL-HPA015284) Datasheet (External Link)
Vendor Page Anti HLTF pAb (ATL-HPA015284) at Atlas Antibodies

Documents & Links for Anti HLTF pAb (ATL-HPA015284)
Datasheet Anti HLTF pAb (ATL-HPA015284) Datasheet (External Link)
Vendor Page Anti HLTF pAb (ATL-HPA015284)
Citations for Anti HLTF pAb (ATL-HPA015284) – 4 Found
Kaur, Gurvinder; Helmer, Rebecca A; Smith, Lisa A; Martinez-Zaguilan, Raul; Dufour, Jannette M; Chilton, Beverly S. Alternative splicing of helicase-like transcription factor (Hltf): Intron retention-dependent activation of immune tolerance at the feto-maternal interface. Plos One. 13(7):e0200211.  PubMed
Helmer, Rebecca A; Foreman, Oded; Dertien, Janet S; Panchoo, Marlyn; Bhakta, Suhani M; Chilton, Beverly S. Role of helicase-like transcription factor (hltf) in the G2/m transition and apoptosis in brain. Plos One. 8(6):e66799.  PubMed
Arcolia, Vanessa; Paci, Paula; Dhont, Ludovic; Chantrain, Gilbert; Sirtaine, Nicolas; Decaestecker, Christine; Remmelink, Myriam; Belayew, Alexandra; Saussez, Sven. Helicase-like transcription factor: a new marker of well-differentiated thyroid cancers. Bmc Cancer. 2014;14( 25005870):492.  PubMed
Helmer, Rebecca A; Martinez-Zaguilan, Raul; Kaur, Gurvinder; Smith, Lisa A; Dufour, Jannette M; Chilton, Beverly S. Helicase-like transcription factor-deletion from the tumor microenvironment in a cell line-derived xenograft model of colorectal cancer reprogrammed the human transcriptome-S-nitroso-proteome to promote inflammation and redirect metastasis. Plos One. 16(5):e0251132.  PubMed