Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031454-25

Protein Description: major histocompatibility complex, class I, E
Gene Name: HLA-E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067235: 75%, ENSRNOG00000050210: 71%
Entrez Gene ID: 3133
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKD
• Gene Sequence: RFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKD
• Gene ID - Mouse: ENSMUSG00000067235
• Gene ID - Rat: ENSRNOG00000050210
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation) – 3 Found

Wang, Yutao; Yan, Kexin; Lin, Jiaxing; Li, Jun; Bi, Jianbin. Macrophage M2 Co-expression Factors Correlate With the Immune Microenvironment and Predict Outcome of Renal Clear Cell Carcinoma. Frontiers In Genetics. 12( 33692827):615655. 

Lorenzo-Herrero, Seila; Sordo-Bahamonde, Christian; Martínez-Pérez, Alejandra; Corte-Torres, Mª Daniela; Fernández-Vega, Iván; Solís-Hernández, Mª Pilar; González, Segundo. Immunoglobulin-like transcript 2 blockade restores antitumor immune responses in glioblastoma. Cancer Science. 2023;114(1):48-62. 

Gerace, Dario; Zhou, Quan; Kenty, Jennifer Hyoje-Ryu; Veres, Adrian; Sintov, Elad; Wang, Xi; Boulanger, Kyle R; Li, Hongfei; Melton, Douglas A. Engineering human stem cell-derived islets to evade immune rejection and promote localized immune tolerance. Cell Reports. Medicine. 2023;4(1):100879.