Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031454-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: HLA-E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067235: 75%, ENSRNOG00000050210: 71%
Entrez Gene ID: 3133
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKD |
| Gene Sequence | RFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKD |
| Gene ID - Mouse | ENSMUSG00000067235 |
| Gene ID - Rat | ENSRNOG00000050210 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation) | |
| Datasheet | Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation) | |
| Datasheet | Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation) |
| Citations for Anti HLA-E pAb (ATL-HPA031454 w/enhanced validation) – 3 Found |
| Wang, Yutao; Yan, Kexin; Lin, Jiaxing; Li, Jun; Bi, Jianbin. Macrophage M2 Co-expression Factors Correlate With the Immune Microenvironment and Predict Outcome of Renal Clear Cell Carcinoma. Frontiers In Genetics. 12( 33692827):615655. PubMed |
| Lorenzo-Herrero, Seila; Sordo-Bahamonde, Christian; Martínez-Pérez, Alejandra; Corte-Torres, Mª Daniela; Fernández-Vega, Iván; Solís-Hernández, Mª Pilar; González, Segundo. Immunoglobulin-like transcript 2 blockade restores antitumor immune responses in glioblastoma. Cancer Science. 2023;114(1):48-62. PubMed |
| Gerace, Dario; Zhou, Quan; Kenty, Jennifer Hyoje-Ryu; Veres, Adrian; Sintov, Elad; Wang, Xi; Boulanger, Kyle R; Li, Hongfei; Melton, Douglas A. Engineering human stem cell-derived islets to evade immune rejection and promote localized immune tolerance. Cell Reports. Medicine. 2023;4(1):100879. PubMed |