Anti HLA-DMB pAb (ATL-HPA012298)

Atlas Antibodies

SKU:
ATL-HPA012298-25
  • Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: major histocompatibility complex, class II, DM beta
Gene Name: HLA-DMB
Alternative Gene Name: D6S221E, RING7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037548: 70%, ENSRNOG00000049491: 73%
Entrez Gene ID: 3109
Uniprot ID: P28068
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQ
Gene Sequence AGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQ
Gene ID - Mouse ENSMUSG00000037548
Gene ID - Rat ENSRNOG00000049491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HLA-DMB pAb (ATL-HPA012298)
Datasheet Anti HLA-DMB pAb (ATL-HPA012298) Datasheet (External Link)
Vendor Page Anti HLA-DMB pAb (ATL-HPA012298) at Atlas Antibodies

Documents & Links for Anti HLA-DMB pAb (ATL-HPA012298)
Datasheet Anti HLA-DMB pAb (ATL-HPA012298) Datasheet (External Link)
Vendor Page Anti HLA-DMB pAb (ATL-HPA012298)