Anti HLA-DMA pAb (ATL-HPA017295)

Atlas Antibodies

Catalog No.:
ATL-HPA017295-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: major histocompatibility complex, class II, DM alpha
Gene Name: HLA-DMA
Alternative Gene Name: D6S222E, RING6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037649: 84%, ENSRNOG00000047854: 85%
Entrez Gene ID: 3108
Uniprot ID: P28067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENV
Gene Sequence LEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENV
Gene ID - Mouse ENSMUSG00000037649
Gene ID - Rat ENSRNOG00000047854
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HLA-DMA pAb (ATL-HPA017295)
Datasheet Anti HLA-DMA pAb (ATL-HPA017295) Datasheet (External Link)
Vendor Page Anti HLA-DMA pAb (ATL-HPA017295) at Atlas Antibodies

Documents & Links for Anti HLA-DMA pAb (ATL-HPA017295)
Datasheet Anti HLA-DMA pAb (ATL-HPA017295) Datasheet (External Link)
Vendor Page Anti HLA-DMA pAb (ATL-HPA017295)