Anti HKR1 pAb (ATL-HPA044855)

Atlas Antibodies

Catalog No.:
ATL-HPA044855-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: HKR1, GLI-Kruppel zinc finger family member
Gene Name: HKR1
Alternative Gene Name: ZNF875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047003: 39%, ENSRNOG00000007489: 39%
Entrez Gene ID: 284459
Uniprot ID: P10072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADLEETDKVLHGLEVSGFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIK
Gene Sequence ADLEETDKVLHGLEVSGFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIK
Gene ID - Mouse ENSMUSG00000047003
Gene ID - Rat ENSRNOG00000007489
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HKR1 pAb (ATL-HPA044855)
Datasheet Anti HKR1 pAb (ATL-HPA044855) Datasheet (External Link)
Vendor Page Anti HKR1 pAb (ATL-HPA044855) at Atlas Antibodies

Documents & Links for Anti HKR1 pAb (ATL-HPA044855)
Datasheet Anti HKR1 pAb (ATL-HPA044855) Datasheet (External Link)
Vendor Page Anti HKR1 pAb (ATL-HPA044855)