Anti HKR1 pAb (ATL-HPA036126)

Atlas Antibodies

SKU:
ATL-HPA036126-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: HKR1, GLI-Kruppel zinc finger family member
Gene Name: HKR1
Alternative Gene Name: ZNF875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004891: 29%, ENSRNOG00000027955: 34%
Entrez Gene ID: 284459
Uniprot ID: P10072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPEDQKQQQDPFCFSGKAEWIQEGEDSRLLFGRVSKNGTSKALSSPPEEQQPAQSKEDNTVVDIGSSPER
Gene Sequence YPEDQKQQQDPFCFSGKAEWIQEGEDSRLLFGRVSKNGTSKALSSPPEEQQPAQSKEDNTVVDIGSSPER
Gene ID - Mouse ENSMUSG00000004891
Gene ID - Rat ENSRNOG00000027955
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HKR1 pAb (ATL-HPA036126)
Datasheet Anti HKR1 pAb (ATL-HPA036126) Datasheet (External Link)
Vendor Page Anti HKR1 pAb (ATL-HPA036126) at Atlas Antibodies

Documents & Links for Anti HKR1 pAb (ATL-HPA036126)
Datasheet Anti HKR1 pAb (ATL-HPA036126) Datasheet (External Link)
Vendor Page Anti HKR1 pAb (ATL-HPA036126)