Anti HJURP pAb (ATL-HPA008436)

Atlas Antibodies

Catalog No.:
ATL-HPA008436-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Holliday junction recognition protein
Gene Name: HJURP
Alternative Gene Name: DKFZp762E1312, FAKTS, hFLEG1, URLC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044783: 37%, ENSRNOG00000022911: 43%
Entrez Gene ID: 55355
Uniprot ID: Q8NCD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRV
Gene Sequence TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRV
Gene ID - Mouse ENSMUSG00000044783
Gene ID - Rat ENSRNOG00000022911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HJURP pAb (ATL-HPA008436)
Datasheet Anti HJURP pAb (ATL-HPA008436) Datasheet (External Link)
Vendor Page Anti HJURP pAb (ATL-HPA008436) at Atlas Antibodies

Documents & Links for Anti HJURP pAb (ATL-HPA008436)
Datasheet Anti HJURP pAb (ATL-HPA008436) Datasheet (External Link)
Vendor Page Anti HJURP pAb (ATL-HPA008436)
Citations for Anti HJURP pAb (ATL-HPA008436) – 8 Found
Filipescu, Dan; Naughtin, Monica; Podsypanina, Katrina; Lejour, Vincent; Wilson, Laurence; Gurard-Levin, Zachary A; Orsi, Guillermo A; Simeonova, Iva; Toufektchan, Eleonore; Attardi, Laura D; Toledo, Franck; Almouzni, Geneviève. Essential role for centromeric factors following p53 loss and oncogenic transformation. Genes & Development. 2017;31(5):463-480.  PubMed
Nye, Jonathan; Sturgill, David; Athwal, Rajbir; Dalal, Yamini. HJURP antagonizes CENP-A mislocalization driven by the H3.3 chaperones HIRA and DAXX. Plos One. 13(10):e0205948.  PubMed
Hammond, Colin M; Bao, Hongyu; Hendriks, Ivo A; Carraro, Massimo; García-Nieto, Alberto; Liu, Yanhong; Reverón-Gómez, Nazaret; Spanos, Christos; Chen, Liu; Rappsilber, Juri; Nielsen, Michael L; Patel, Dinshaw J; Huang, Hongda; Groth, Anja. DNAJC9 integrates heat shock molecular chaperones into the histone chaperone network. Molecular Cell. 2021;81(12):2533-2548.e9.  PubMed
Shuaib, Muhammad; Ouararhni, Khalid; Dimitrov, Stefan; Hamiche, Ali. HJURP binds CENP-A via a highly conserved N-terminal domain and mediates its deposition at centromeres. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2010;107(4):1349-54.  PubMed
Hu, Zhi; Huang, Ge; Sadanandam, Anguraj; Gu, Shenda; Lenburg, Marc E; Pai, Melody; Bayani, Nora; Blakely, Eleanor A; Gray, Joe W; Mao, Jian-Hua. The expression level of HJURP has an independent prognostic impact and predicts the sensitivity to radiotherapy in breast cancer. Breast Cancer Research : Bcr. 12(2):R18.  PubMed
de Tayrac, Marie; Saikali, Stephan; Aubry, Marc; Bellaud, Pascale; Boniface, Rachel; Quillien, Véronique; Mosser, Jean. Prognostic significance of EDN/RB, HJURP, p60/CAF-1 and PDLI4, four new markers in high-grade gliomas. Plos One. 8(9):e73332.  PubMed
Huang, Wenfeng; Zhang, Hongxing; Hao, Yumin; Xu, Xiaobing; Zhai, Yun; Wang, Shaoxia; Li, Yang; Ma, Fuchao; Li, Yuanfeng; Wang, Zhifu; Zhang, Yang; Zhang, Xiumei; Liang, Renxiang; Wei, Zhongliang; Cui, Ying; Li, Yongqiang; Yu, Xinsen; Ji, Hongzan; He, Fuchu; Xie, Weimin; Zhou, Gangqiao. A Non-Synonymous Single Nucleotide Polymorphism in the HJURP Gene Associated with Susceptibility to Hepatocellular Carcinoma among Chinese. Plos One. 11(2):e0148618.  PubMed
Jeffery, Daniel; Gatto, Alberto; Podsypanina, Katrina; Renaud-Pageot, Charlène; Ponce Landete, Rebeca; Bonneville, Lorraine; Dumont, Marie; Fachinetti, Daniele; Almouzni, Geneviève. CENP-A overexpression promotes distinct fates in human cells, depending on p53 status. Communications Biology. 2021;4(1):417.  PubMed