Anti HIPK3 pAb (ATL-HPA028069)

Atlas Antibodies

Catalog No.:
ATL-HPA028069-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: homeodomain interacting protein kinase 3
Gene Name: HIPK3
Alternative Gene Name: DYRK6, FIST3, PKY, YAK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027177: 85%, ENSRNOG00000011358: 85%
Entrez Gene ID: 10114
Uniprot ID: Q9H422
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHLNSCDTNNHNKTSLLRPVASSSTATLTANFTKIGTLRSQALTTSAHSVVHHGIPLQAGTAQFGCGDAFQQTLIICPPAIQGIPA
Gene Sequence SHLNSCDTNNHNKTSLLRPVASSSTATLTANFTKIGTLRSQALTTSAHSVVHHGIPLQAGTAQFGCGDAFQQTLIICPPAIQGIPA
Gene ID - Mouse ENSMUSG00000027177
Gene ID - Rat ENSRNOG00000011358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HIPK3 pAb (ATL-HPA028069)
Datasheet Anti HIPK3 pAb (ATL-HPA028069) Datasheet (External Link)
Vendor Page Anti HIPK3 pAb (ATL-HPA028069) at Atlas Antibodies

Documents & Links for Anti HIPK3 pAb (ATL-HPA028069)
Datasheet Anti HIPK3 pAb (ATL-HPA028069) Datasheet (External Link)
Vendor Page Anti HIPK3 pAb (ATL-HPA028069)