Anti HIPK3 pAb (ATL-HPA028069)

Atlas Antibodies

SKU: ATL-HPA028069-25

• 
• 

Protein Description: homeodomain interacting protein kinase 3
Gene Name: HIPK3
Alternative Gene Name: DYRK6, FIST3, PKY, YAK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027177: 85%, ENSRNOG00000011358: 85%
Entrez Gene ID: 10114
Uniprot ID: Q9H422
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHLNSCDTNNHNKTSLLRPVASSSTATLTANFTKIGTLRSQALTTSAHSVVHHGIPLQAGTAQFGCGDAFQQTLIICPPAIQGIPA
• Gene Sequence: SHLNSCDTNNHNKTSLLRPVASSSTATLTANFTKIGTLRSQALTTSAHSVVHHGIPLQAGTAQFGCGDAFQQTLIICPPAIQGIPA
• Gene ID - Mouse: ENSMUSG00000027177
• Gene ID - Rat: ENSRNOG00000011358
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.