Anti HIP1R pAb (ATL-HPA038136 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA038136-25
  • Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-HIP1R antibody HPA038136 (A) shows similar protein distribution across tissues to independent antibody HPA038135 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: huntingtin interacting protein 1 related
Gene Name: HIP1R
Alternative Gene Name: FLJ14000, HIP12, HIP3, ILWEQ, KIAA0655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000915: 85%, ENSRNOG00000001091: 87%
Entrez Gene ID: 9026
Uniprot ID: O75146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RESQEQGLRQRLLDEQFAVLRGAAAEAAGILQDAVSKLDDPLHLRCTSSPDYLVSRAQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAADTIINGGATSHLA
Gene Sequence RESQEQGLRQRLLDEQFAVLRGAAAEAAGILQDAVSKLDDPLHLRCTSSPDYLVSRAQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAADTIINGGATSHLA
Gene ID - Mouse ENSMUSG00000000915
Gene ID - Rat ENSRNOG00000001091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HIP1R pAb (ATL-HPA038136 w/enhanced validation)
Datasheet Anti HIP1R pAb (ATL-HPA038136 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIP1R pAb (ATL-HPA038136 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HIP1R pAb (ATL-HPA038136 w/enhanced validation)
Datasheet Anti HIP1R pAb (ATL-HPA038136 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIP1R pAb (ATL-HPA038136 w/enhanced validation)