Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038135-25

• 
• 
• 

Protein Description: huntingtin interacting protein 1 related
Gene Name: HIP1R
Alternative Gene Name: FLJ14000, HIP12, HIP3, ILWEQ, KIAA0655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000915: 89%, ENSRNOG00000001091: 89%
Entrez Gene ID: 9026
Uniprot ID: O75146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR
• Gene Sequence: VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR
• Gene ID - Mouse: ENSMUSG00000000915
• Gene ID - Rat: ENSRNOG00000001091
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.