Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038135-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HIP1R
Alternative Gene Name: FLJ14000, HIP12, HIP3, ILWEQ, KIAA0655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000915: 89%, ENSRNOG00000001091: 89%
Entrez Gene ID: 9026
Uniprot ID: O75146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR |
| Gene Sequence | VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR |
| Gene ID - Mouse | ENSMUSG00000000915 |
| Gene ID - Rat | ENSRNOG00000001091 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) | |
| Datasheet | Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) | |
| Datasheet | Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) |