Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA038135-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HIP1R
Alternative Gene Name: FLJ14000, HIP12, HIP3, ILWEQ, KIAA0655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000915: 89%, ENSRNOG00000001091: 89%
Entrez Gene ID: 9026
Uniprot ID: O75146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR |
Gene Sequence | VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR |
Gene ID - Mouse | ENSMUSG00000000915 |
Gene ID - Rat | ENSRNOG00000001091 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) | |
Datasheet | Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) | |
Datasheet | Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HIP1R pAb (ATL-HPA038135 w/enhanced validation) |