Anti HIP1 pAb (ATL-HPA013606 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA013606-25
  • Immunohistochemistry analysis in human testis and liver tissues using Anti-HIP1 antibody. Corresponding HIP1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
  • Western blot analysis in human cell lines A-549 and Caco-2 using Anti-HIP1 antibody. Corresponding HIP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: huntingtin interacting protein 1
Gene Name: HIP1
Alternative Gene Name: ILWEQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039959: 88%, ENSRNOG00000001448: 88%
Entrez Gene ID: 3092
Uniprot ID: O00291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen NFLRASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQRED
Gene Sequence NFLRASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQRED
Gene ID - Mouse ENSMUSG00000039959
Gene ID - Rat ENSRNOG00000001448
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HIP1 pAb (ATL-HPA013606 w/enhanced validation)
Datasheet Anti HIP1 pAb (ATL-HPA013606 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIP1 pAb (ATL-HPA013606 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HIP1 pAb (ATL-HPA013606 w/enhanced validation)
Datasheet Anti HIP1 pAb (ATL-HPA013606 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIP1 pAb (ATL-HPA013606 w/enhanced validation)



Citations for Anti HIP1 pAb (ATL-HPA013606 w/enhanced validation) – 1 Found
Majeed, Sophia R; Vasudevan, Lavanya; Chen, Chih-Ying; Luo, Yi; Torres, Jorge A; Evans, Timothy M; Sharkey, Andrew; Foraker, Amy B; Wong, Nicole M L; Esk, Christopher; Freeman, Theresa A; Moffett, Ashley; Keen, James H; Brodsky, Frances M. Clathrin light chains are required for the gyrating-clathrin recycling pathway and thereby promote cell migration. Nature Communications. 2014;5( 24852344):3891.  PubMed