Anti HINT1 pAb (ATL-HPA044577)

Atlas Antibodies

SKU:
ATL-HPA044577-25
  • Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: histidine triad nucleotide binding protein 1
Gene Name: HINT1
Alternative Gene Name: HINT, PKCI-1, PRKCNH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020267: 92%, ENSRNOG00000005630: 92%
Entrez Gene ID: 3094
Uniprot ID: P49773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen IPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVL
Gene Sequence IPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVL
Gene ID - Mouse ENSMUSG00000020267
Gene ID - Rat ENSRNOG00000005630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HINT1 pAb (ATL-HPA044577)
Datasheet Anti HINT1 pAb (ATL-HPA044577) Datasheet (External Link)
Vendor Page Anti HINT1 pAb (ATL-HPA044577) at Atlas Antibodies

Documents & Links for Anti HINT1 pAb (ATL-HPA044577)
Datasheet Anti HINT1 pAb (ATL-HPA044577) Datasheet (External Link)
Vendor Page Anti HINT1 pAb (ATL-HPA044577)



Citations for Anti HINT1 pAb (ATL-HPA044577) – 1 Found
Yan, Victoria C; Muller, Florian L. Advantages of the Parent Nucleoside GS-441524 over Remdesivir for Covid-19 Treatment. Acs Medicinal Chemistry Letters. 2020;11(7):1361-1366.  PubMed
!