Anti HIKESHI pAb (ATL-HPA035063)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035063-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HIKESHI
Alternative Gene Name: C11orf73, HSPC138, HSPC179, OPI10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062797: 97%, ENSRNOG00000017383: 97%
Entrez Gene ID: 51501
Uniprot ID: Q53FT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKI |
| Gene Sequence | GRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKI |
| Gene ID - Mouse | ENSMUSG00000062797 |
| Gene ID - Rat | ENSRNOG00000017383 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HIKESHI pAb (ATL-HPA035063) | |
| Datasheet | Anti HIKESHI pAb (ATL-HPA035063) Datasheet (External Link) |
| Vendor Page | Anti HIKESHI pAb (ATL-HPA035063) at Atlas Antibodies |
| Documents & Links for Anti HIKESHI pAb (ATL-HPA035063) | |
| Datasheet | Anti HIKESHI pAb (ATL-HPA035063) Datasheet (External Link) |
| Vendor Page | Anti HIKESHI pAb (ATL-HPA035063) |