Anti HIKESHI pAb (ATL-HPA035063)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035063-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HIKESHI
Alternative Gene Name: C11orf73, HSPC138, HSPC179, OPI10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062797: 97%, ENSRNOG00000017383: 97%
Entrez Gene ID: 51501
Uniprot ID: Q53FT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKI |
Gene Sequence | GRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKI |
Gene ID - Mouse | ENSMUSG00000062797 |
Gene ID - Rat | ENSRNOG00000017383 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HIKESHI pAb (ATL-HPA035063) | |
Datasheet | Anti HIKESHI pAb (ATL-HPA035063) Datasheet (External Link) |
Vendor Page | Anti HIKESHI pAb (ATL-HPA035063) at Atlas Antibodies |
Documents & Links for Anti HIKESHI pAb (ATL-HPA035063) | |
Datasheet | Anti HIKESHI pAb (ATL-HPA035063) Datasheet (External Link) |
Vendor Page | Anti HIKESHI pAb (ATL-HPA035063) |