Anti HIKESHI pAb (ATL-HPA012708)

Atlas Antibodies

SKU:
ATL-HPA012708-25
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm, nuclear speckles & nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Hikeshi, heat shock protein nuclear import factor
Gene Name: HIKESHI
Alternative Gene Name: C11orf73, HSPC138, HSPC179, OPI10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062797: 97%, ENSRNOG00000017383: 97%
Entrez Gene ID: 51501
Uniprot ID: Q53FT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQN
Gene Sequence LGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQN
Gene ID - Mouse ENSMUSG00000062797
Gene ID - Rat ENSRNOG00000017383
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HIKESHI pAb (ATL-HPA012708)
Datasheet Anti HIKESHI pAb (ATL-HPA012708) Datasheet (External Link)
Vendor Page Anti HIKESHI pAb (ATL-HPA012708) at Atlas Antibodies

Documents & Links for Anti HIKESHI pAb (ATL-HPA012708)
Datasheet Anti HIKESHI pAb (ATL-HPA012708) Datasheet (External Link)
Vendor Page Anti HIKESHI pAb (ATL-HPA012708)