Anti HIGD2B pAb (ATL-HPA019016)

Atlas Antibodies

Catalog No.: ATL-HPA019016-25

Protein Description: HIG1 hypoxia inducible domain family, member 2B
Gene Name: HIGD2B
Alternative Gene Name: HIGD2BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025868: 79%, ENSRNOG00000017372: 74%
Entrez Gene ID:
Uniprot ID: Q4VC39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENP
• Gene Sequence: MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENP
• Gene ID - Mouse: ENSMUSG00000025868
• Gene ID - Rat: ENSRNOG00000017372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.