Anti HIGD2B pAb (ATL-HPA019016)

Atlas Antibodies

Catalog No.:
ATL-HPA019016-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: HIG1 hypoxia inducible domain family, member 2B
Gene Name: HIGD2B
Alternative Gene Name: HIGD2BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025868: 79%, ENSRNOG00000017372: 74%
Entrez Gene ID:
Uniprot ID: Q4VC39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENP
Gene Sequence MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENP
Gene ID - Mouse ENSMUSG00000025868
Gene ID - Rat ENSRNOG00000017372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HIGD2B pAb (ATL-HPA019016)
Datasheet Anti HIGD2B pAb (ATL-HPA019016) Datasheet (External Link)
Vendor Page Anti HIGD2B pAb (ATL-HPA019016) at Atlas Antibodies

Documents & Links for Anti HIGD2B pAb (ATL-HPA019016)
Datasheet Anti HIGD2B pAb (ATL-HPA019016) Datasheet (External Link)
Vendor Page Anti HIGD2B pAb (ATL-HPA019016)