Anti HIGD2A pAb (ATL-HPA042715)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042715-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HIGD2A
Alternative Gene Name: MGC2198
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025868: 86%, ENSRNOG00000017372: 83%
Entrez Gene ID: 192286
Uniprot ID: Q9BW72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN |
| Gene Sequence | PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN |
| Gene ID - Mouse | ENSMUSG00000025868 |
| Gene ID - Rat | ENSRNOG00000017372 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HIGD2A pAb (ATL-HPA042715) | |
| Datasheet | Anti HIGD2A pAb (ATL-HPA042715) Datasheet (External Link) |
| Vendor Page | Anti HIGD2A pAb (ATL-HPA042715) at Atlas Antibodies |
| Documents & Links for Anti HIGD2A pAb (ATL-HPA042715) | |
| Datasheet | Anti HIGD2A pAb (ATL-HPA042715) Datasheet (External Link) |
| Vendor Page | Anti HIGD2A pAb (ATL-HPA042715) |
| Citations for Anti HIGD2A pAb (ATL-HPA042715) – 1 Found |
| Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615. PubMed |