Anti HIGD2A pAb (ATL-HPA042715)

Atlas Antibodies

Catalog No.:
ATL-HPA042715-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: HIG1 hypoxia inducible domain family, member 2A
Gene Name: HIGD2A
Alternative Gene Name: MGC2198
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025868: 86%, ENSRNOG00000017372: 83%
Entrez Gene ID: 192286
Uniprot ID: Q9BW72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN
Gene Sequence PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN
Gene ID - Mouse ENSMUSG00000025868
Gene ID - Rat ENSRNOG00000017372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HIGD2A pAb (ATL-HPA042715)
Datasheet Anti HIGD2A pAb (ATL-HPA042715) Datasheet (External Link)
Vendor Page Anti HIGD2A pAb (ATL-HPA042715) at Atlas Antibodies

Documents & Links for Anti HIGD2A pAb (ATL-HPA042715)
Datasheet Anti HIGD2A pAb (ATL-HPA042715) Datasheet (External Link)
Vendor Page Anti HIGD2A pAb (ATL-HPA042715)
Citations for Anti HIGD2A pAb (ATL-HPA042715) – 1 Found
Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615.  PubMed