Anti HIGD2A pAb (ATL-HPA042715)

Atlas Antibodies

SKU: ATL-HPA042715-25

• 
• 
• 

Protein Description: HIG1 hypoxia inducible domain family, member 2A
Gene Name: HIGD2A
Alternative Gene Name: MGC2198
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025868: 86%, ENSRNOG00000017372: 83%
Entrez Gene ID: 192286
Uniprot ID: Q9BW72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN
• Gene Sequence: PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN
• Gene ID - Mouse: ENSMUSG00000025868
• Gene ID - Rat: ENSRNOG00000017372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HIGD2A pAb (ATL-HPA042715) – 1 Found

Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615.