Anti HIF1A pAb (ATL-HPA000907)

Atlas Antibodies

Catalog No.:
ATL-HPA000907-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Gene Name: HIF1A
Alternative Gene Name: bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021109: 87%, ENSRNOG00000008292: 88%
Entrez Gene ID: 3091
Uniprot ID: Q16665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD
Gene Sequence KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD
Gene ID - Mouse ENSMUSG00000021109
Gene ID - Rat ENSRNOG00000008292
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HIF1A pAb (ATL-HPA000907)
Datasheet Anti HIF1A pAb (ATL-HPA000907) Datasheet (External Link)
Vendor Page Anti HIF1A pAb (ATL-HPA000907) at Atlas Antibodies

Documents & Links for Anti HIF1A pAb (ATL-HPA000907)
Datasheet Anti HIF1A pAb (ATL-HPA000907) Datasheet (External Link)
Vendor Page Anti HIF1A pAb (ATL-HPA000907)
Citations for Anti HIF1A pAb (ATL-HPA000907) – 2 Found
Danielsson, Frida; Fasterius, Erik; Sullivan, Devin; Hases, Linnea; Sanli, Kemal; Zhang, Cheng; Mardinoglu, Adil; Al-Khalili, Cristina; Huss, Mikael; Uhlén, Mathias; Williams, Cecilia; Lundberg, Emma. Transcriptome profiling of the interconnection of pathways involved in malignant transformation and response to hypoxia. Oncotarget. 2018;9(28):19730-19744.  PubMed
Kapeleris, Joanna; Müller Bark, Juliana; Ranjit, Shanon; Richard, Derek; Vela, Ian; O'Byrne, Kenneth; Punyadeera, Chamindie. Modelling reoxygenation effects in non-small cell lung cancer cell lines and showing epithelial-mesenchymal transition. Journal Of Cancer Research And Clinical Oncology. 2022;148(12):3501-3510.  PubMed