Anti HIF1A pAb (ATL-HPA000907)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000907-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: HIF1A
Alternative Gene Name: bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021109: 87%, ENSRNOG00000008292: 88%
Entrez Gene ID: 3091
Uniprot ID: Q16665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD |
Gene Sequence | KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD |
Gene ID - Mouse | ENSMUSG00000021109 |
Gene ID - Rat | ENSRNOG00000008292 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HIF1A pAb (ATL-HPA000907) | |
Datasheet | Anti HIF1A pAb (ATL-HPA000907) Datasheet (External Link) |
Vendor Page | Anti HIF1A pAb (ATL-HPA000907) at Atlas Antibodies |
Documents & Links for Anti HIF1A pAb (ATL-HPA000907) | |
Datasheet | Anti HIF1A pAb (ATL-HPA000907) Datasheet (External Link) |
Vendor Page | Anti HIF1A pAb (ATL-HPA000907) |
Citations for Anti HIF1A pAb (ATL-HPA000907) – 2 Found |
Danielsson, Frida; Fasterius, Erik; Sullivan, Devin; Hases, Linnea; Sanli, Kemal; Zhang, Cheng; Mardinoglu, Adil; Al-Khalili, Cristina; Huss, Mikael; Uhlén, Mathias; Williams, Cecilia; Lundberg, Emma. Transcriptome profiling of the interconnection of pathways involved in malignant transformation and response to hypoxia. Oncotarget. 2018;9(28):19730-19744. PubMed |
Kapeleris, Joanna; Müller Bark, Juliana; Ranjit, Shanon; Richard, Derek; Vela, Ian; O'Byrne, Kenneth; Punyadeera, Chamindie. Modelling reoxygenation effects in non-small cell lung cancer cell lines and showing epithelial-mesenchymal transition. Journal Of Cancer Research And Clinical Oncology. 2022;148(12):3501-3510. PubMed |