Anti HID1 pAb (ATL-HPA023095 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA023095-25
  • Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in superficial squamous epithelial cells.
  • Western blot analysis in human cell lines MCF-7 and SK-MEL-30 using Anti-HID1 antibody. Corresponding HID1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HID1 domain containing
Gene Name: HID1
Alternative Gene Name: C17orf28, DMC1, HID-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034586: 93%, ENSRNOG00000003464: 93%
Entrez Gene ID: 283987
Uniprot ID: Q8IV36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAM
Gene Sequence RPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAM
Gene ID - Mouse ENSMUSG00000034586
Gene ID - Rat ENSRNOG00000003464
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HID1 pAb (ATL-HPA023095 w/enhanced validation)
Datasheet Anti HID1 pAb (ATL-HPA023095 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HID1 pAb (ATL-HPA023095 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HID1 pAb (ATL-HPA023095 w/enhanced validation)
Datasheet Anti HID1 pAb (ATL-HPA023095 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HID1 pAb (ATL-HPA023095 w/enhanced validation)