Anti HIC2 pAb (ATL-HPA031884)

Atlas Antibodies

SKU: ATL-HPA031884-25

• 

Protein Description: hypermethylated in cancer 2
Gene Name: HIC2
Alternative Gene Name: HRG22, KIAA1020, ZBTB30, ZNF907
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050240: 96%, ENSRNOG00000051458: 95%
Entrez Gene ID: 23119
Uniprot ID: Q96JB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAHVETHTEEELFIKEEGAYETGSGGAEEEAEDLSAPSAAYTAEPRPFKCSVCEKTYKDPATLRQHEKTHWLTRP
• Gene Sequence: NAHVETHTEEELFIKEEGAYETGSGGAEEEAEDLSAPSAAYTAEPRPFKCSVCEKTYKDPATLRQHEKTHWLTRP
• Gene ID - Mouse: ENSMUSG00000050240
• Gene ID - Rat: ENSRNOG00000051458
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.