Anti HIC1 pAb (ATL-HPA043372)

Atlas Antibodies

Catalog No.: ATL-HPA043372-25

Protein Description: hypermethylated in cancer 1
Gene Name: HIC1
Alternative Gene Name: ZBTB29, ZNF901
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043099: 98%, ENSRNOG00000057619: 97%
Entrez Gene ID: 3090
Uniprot ID: Q14526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT
• Gene Sequence: ELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT
• Gene ID - Mouse: ENSMUSG00000043099
• Gene ID - Rat: ENSRNOG00000057619
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.