Anti HIC1 pAb (ATL-HPA043372)

Atlas Antibodies

SKU:
ATL-HPA043372-25
  • Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: hypermethylated in cancer 1
Gene Name: HIC1
Alternative Gene Name: ZBTB29, ZNF901
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043099: 98%, ENSRNOG00000057619: 97%
Entrez Gene ID: 3090
Uniprot ID: Q14526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT
Gene Sequence ELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT
Gene ID - Mouse ENSMUSG00000043099
Gene ID - Rat ENSRNOG00000057619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HIC1 pAb (ATL-HPA043372)
Datasheet Anti HIC1 pAb (ATL-HPA043372) Datasheet (External Link)
Vendor Page Anti HIC1 pAb (ATL-HPA043372) at Atlas Antibodies

Documents & Links for Anti HIC1 pAb (ATL-HPA043372)
Datasheet Anti HIC1 pAb (ATL-HPA043372) Datasheet (External Link)
Vendor Page Anti HIC1 pAb (ATL-HPA043372)