Anti HIBCH pAb (ATL-HPA036541 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036541-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HIBCH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041426: 87%, ENSRNOG00000028557: 88%
Entrez Gene ID: 26275
Uniprot ID: Q6NVY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLNNHFKSLGSSDL |
| Gene Sequence | GSSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLNNHFKSLGSSDL |
| Gene ID - Mouse | ENSMUSG00000041426 |
| Gene ID - Rat | ENSRNOG00000028557 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HIBCH pAb (ATL-HPA036541 w/enhanced validation) | |
| Datasheet | Anti HIBCH pAb (ATL-HPA036541 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HIBCH pAb (ATL-HPA036541 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HIBCH pAb (ATL-HPA036541 w/enhanced validation) | |
| Datasheet | Anti HIBCH pAb (ATL-HPA036541 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HIBCH pAb (ATL-HPA036541 w/enhanced validation) |
| Citations for Anti HIBCH pAb (ATL-HPA036541 w/enhanced validation) – 1 Found |
| Nilsen, Mona S; Jersin, Regine Å; Ulvik, Arve; Madsen, André; McCann, Adrian; Svensson, Per-Arne; Svensson, Maria K; Nedrebø, Bjørn G; Gudbrandsen, Oddrun A; Tell, Grethe S; Kahn, C R; Ueland, Per M; Mellgren, Gunnar; Dankel, Simon N. 3-Hydroxyisobutyrate, A Strong Marker of Insulin Resistance in Type 2 Diabetes and Obesity That Modulates White and Brown Adipocyte Metabolism. Diabetes. 2020;69(9):1903-1916. PubMed |