Anti HIBCH pAb (ATL-HPA036540 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036540-25
  • Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-HIBCH antibody. Corresponding HIBCH RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
  • Western blot analysis using Anti-HIBCH antibody HPA036540 (A) shows similar pattern to independent antibody HPA036541 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: 3-hydroxyisobutyryl-CoA hydrolase
Gene Name: HIBCH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041426: 82%, ENSRNOG00000028557: 82%
Entrez Gene ID: 26275
Uniprot ID: Q6NVY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEI
Gene Sequence PRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEI
Gene ID - Mouse ENSMUSG00000041426
Gene ID - Rat ENSRNOG00000028557
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HIBCH pAb (ATL-HPA036540 w/enhanced validation)
Datasheet Anti HIBCH pAb (ATL-HPA036540 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIBCH pAb (ATL-HPA036540 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HIBCH pAb (ATL-HPA036540 w/enhanced validation)
Datasheet Anti HIBCH pAb (ATL-HPA036540 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIBCH pAb (ATL-HPA036540 w/enhanced validation)