Anti HHAT pAb (ATL-HPA016462)

Atlas Antibodies

SKU: ATL-HPA016462-25

• 
• 

Protein Description: hedgehog acyltransferase
Gene Name: HHAT
Alternative Gene Name: FLJ10724, GUP2, MART-2, MART2, rasp, sit, ski, Skn
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037375: 92%, ENSRNOG00000003925: 82%
Entrez Gene ID: 55733
Uniprot ID: Q5VTY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEW
• Gene Sequence: VSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEW
• Gene ID - Mouse: ENSMUSG00000037375
• Gene ID - Rat: ENSRNOG00000003925
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.