Anti HGH1 pAb (ATL-HPA042470)

Atlas Antibodies

SKU:
ATL-HPA042470-25
  • Immunohistochemical staining of human small intestine shows moderate cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HGH1 homolog
Gene Name: HGH1
Alternative Gene Name: C8orf30A, C8orf30B, FAM203A, FAM203B, FLJ40907, LOC51236
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022554: 87%, ENSRNOG00000029238: 82%
Entrez Gene ID: 51236
Uniprot ID: Q9BTY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLEREL
Gene Sequence LVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLEREL
Gene ID - Mouse ENSMUSG00000022554
Gene ID - Rat ENSRNOG00000029238
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HGH1 pAb (ATL-HPA042470)
Datasheet Anti HGH1 pAb (ATL-HPA042470) Datasheet (External Link)
Vendor Page Anti HGH1 pAb (ATL-HPA042470) at Atlas Antibodies

Documents & Links for Anti HGH1 pAb (ATL-HPA042470)
Datasheet Anti HGH1 pAb (ATL-HPA042470) Datasheet (External Link)
Vendor Page Anti HGH1 pAb (ATL-HPA042470)