Anti HGH1 pAb (ATL-HPA042470)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042470-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HGH1
Alternative Gene Name: C8orf30A, C8orf30B, FAM203A, FAM203B, FLJ40907, LOC51236
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022554: 87%, ENSRNOG00000029238: 82%
Entrez Gene ID: 51236
Uniprot ID: Q9BTY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLEREL |
| Gene Sequence | LVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLEREL |
| Gene ID - Mouse | ENSMUSG00000022554 |
| Gene ID - Rat | ENSRNOG00000029238 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HGH1 pAb (ATL-HPA042470) | |
| Datasheet | Anti HGH1 pAb (ATL-HPA042470) Datasheet (External Link) |
| Vendor Page | Anti HGH1 pAb (ATL-HPA042470) at Atlas Antibodies |
| Documents & Links for Anti HGH1 pAb (ATL-HPA042470) | |
| Datasheet | Anti HGH1 pAb (ATL-HPA042470) Datasheet (External Link) |
| Vendor Page | Anti HGH1 pAb (ATL-HPA042470) |