Anti HFM1 pAb (ATL-HPA035557)

Atlas Antibodies

SKU:
ATL-HPA035557-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae)
Gene Name: HFM1
Alternative Gene Name: FLJ36760, FLJ39011, MER3, SEC63D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043410: 57%, ENSRNOG00000023299: 56%
Entrez Gene ID: 164045
Uniprot ID: A2PYH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCK
Gene Sequence FVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCK
Gene ID - Mouse ENSMUSG00000043410
Gene ID - Rat ENSRNOG00000023299
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HFM1 pAb (ATL-HPA035557)
Datasheet Anti HFM1 pAb (ATL-HPA035557) Datasheet (External Link)
Vendor Page Anti HFM1 pAb (ATL-HPA035557) at Atlas Antibodies

Documents & Links for Anti HFM1 pAb (ATL-HPA035557)
Datasheet Anti HFM1 pAb (ATL-HPA035557) Datasheet (External Link)
Vendor Page Anti HFM1 pAb (ATL-HPA035557)