Anti HEXDC pAb (ATL-HPA027844)

Atlas Antibodies

SKU:
ATL-HPA027844-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Gene Name: HEXDC
Alternative Gene Name: FLJ23825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011096: 29%, ENSRNOG00000050573: 30%
Entrez Gene ID: 284004
Uniprot ID: Q8WVB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SARCLPPRCHPPALAGTLLRTPEGRAHARGLLLEAGGALHCQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPAL
Gene Sequence SARCLPPRCHPPALAGTLLRTPEGRAHARGLLLEAGGALHCQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPAL
Gene ID - Mouse ENSMUSG00000011096
Gene ID - Rat ENSRNOG00000050573
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HEXDC pAb (ATL-HPA027844)
Datasheet Anti HEXDC pAb (ATL-HPA027844) Datasheet (External Link)
Vendor Page Anti HEXDC pAb (ATL-HPA027844) at Atlas Antibodies

Documents & Links for Anti HEXDC pAb (ATL-HPA027844)
Datasheet Anti HEXDC pAb (ATL-HPA027844) Datasheet (External Link)
Vendor Page Anti HEXDC pAb (ATL-HPA027844)