Anti HEXDC pAb (ATL-HPA023379 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA023379-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in granular layer cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & mitochondria.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and HEXDC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406510).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Gene Name: HEXDC
Alternative Gene Name: FLJ23825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039307: 79%, ENSRNOG00000036667: 80%
Entrez Gene ID: 284004
Uniprot ID: Q8WVB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQRYDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVEN
Gene Sequence ASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQRYDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVEN
Gene ID - Mouse ENSMUSG00000039307
Gene ID - Rat ENSRNOG00000036667
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HEXDC pAb (ATL-HPA023379 w/enhanced validation)
Datasheet Anti HEXDC pAb (ATL-HPA023379 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HEXDC pAb (ATL-HPA023379 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HEXDC pAb (ATL-HPA023379 w/enhanced validation)
Datasheet Anti HEXDC pAb (ATL-HPA023379 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HEXDC pAb (ATL-HPA023379 w/enhanced validation)