Anti HEXDC pAb (ATL-HPA022834)

Atlas Antibodies

Catalog No.:
ATL-HPA022834-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Gene Name: HEXDC
Alternative Gene Name: FLJ23825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039307: 87%, ENSRNOG00000036667: 85%
Entrez Gene ID: 284004
Uniprot ID: Q8WVB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPLFRALGANGLLIEYEDMFPYEGPLRLLRAKYAYSPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEAESLALVGAMIDQVLE
Gene Sequence FPLFRALGANGLLIEYEDMFPYEGPLRLLRAKYAYSPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEAESLALVGAMIDQVLE
Gene ID - Mouse ENSMUSG00000039307
Gene ID - Rat ENSRNOG00000036667
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HEXDC pAb (ATL-HPA022834)
Datasheet Anti HEXDC pAb (ATL-HPA022834) Datasheet (External Link)
Vendor Page Anti HEXDC pAb (ATL-HPA022834) at Atlas Antibodies

Documents & Links for Anti HEXDC pAb (ATL-HPA022834)
Datasheet Anti HEXDC pAb (ATL-HPA022834) Datasheet (External Link)
Vendor Page Anti HEXDC pAb (ATL-HPA022834)