Anti HERPUD1 pAb (ATL-HPA041219)

Atlas Antibodies

Catalog No.:
ATL-HPA041219-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Gene Name: HERPUD1
Alternative Gene Name: HERP, KIAA0025, Mif1, SUP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031770: 94%, ENSRNOG00000018796: 94%
Entrez Gene ID: 9709
Uniprot ID: Q15011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRD
Gene Sequence LGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRD
Gene ID - Mouse ENSMUSG00000031770
Gene ID - Rat ENSRNOG00000018796
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HERPUD1 pAb (ATL-HPA041219)
Datasheet Anti HERPUD1 pAb (ATL-HPA041219) Datasheet (External Link)
Vendor Page Anti HERPUD1 pAb (ATL-HPA041219) at Atlas Antibodies

Documents & Links for Anti HERPUD1 pAb (ATL-HPA041219)
Datasheet Anti HERPUD1 pAb (ATL-HPA041219) Datasheet (External Link)
Vendor Page Anti HERPUD1 pAb (ATL-HPA041219)