Anti HERC4 pAb (ATL-HPA045453)

Atlas Antibodies

Catalog No.:
ATL-HPA045453-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HECT and RLD domain containing E3 ubiquitin protein ligase 4
Gene Name: HERC4
Alternative Gene Name: DKFZP564G092, KIAA1593
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020064: 99%, ENSRNOG00000061040: 98%
Entrez Gene ID: 26091
Uniprot ID: Q5GLZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FHKLIQPDHPQISQQVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAPLKVLENWWSVLEPPLFLK
Gene Sequence FHKLIQPDHPQISQQVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAPLKVLENWWSVLEPPLFLK
Gene ID - Mouse ENSMUSG00000020064
Gene ID - Rat ENSRNOG00000061040
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HERC4 pAb (ATL-HPA045453)
Datasheet Anti HERC4 pAb (ATL-HPA045453) Datasheet (External Link)
Vendor Page Anti HERC4 pAb (ATL-HPA045453) at Atlas Antibodies

Documents & Links for Anti HERC4 pAb (ATL-HPA045453)
Datasheet Anti HERC4 pAb (ATL-HPA045453) Datasheet (External Link)
Vendor Page Anti HERC4 pAb (ATL-HPA045453)