Anti HERC4 pAb (ATL-HPA045453)

Atlas Antibodies

Catalog No.: ATL-HPA045453-25

Protein Description: HECT and RLD domain containing E3 ubiquitin protein ligase 4
Gene Name: HERC4
Alternative Gene Name: DKFZP564G092, KIAA1593
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020064: 99%, ENSRNOG00000061040: 98%
Entrez Gene ID: 26091
Uniprot ID: Q5GLZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FHKLIQPDHPQISQQVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAPLKVLENWWSVLEPPLFLK
• Gene Sequence: FHKLIQPDHPQISQQVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAPLKVLENWWSVLEPPLFLK
• Gene ID - Mouse: ENSMUSG00000020064
• Gene ID - Rat: ENSRNOG00000061040
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.