Anti HENMT1 pAb (ATL-HPA028497 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028497-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HENMT1
Alternative Gene Name: C1orf59, FLJ30525, HEN1
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 113802
Uniprot ID: Q5T8I9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FNPLFPSVTLRDSDHKFEWTRMEFQTWALYVANRYDYSVEFTGVGEPPAGAENVGYCTQIGIFRKNGGKATESCLS |
Gene Sequence | FNPLFPSVTLRDSDHKFEWTRMEFQTWALYVANRYDYSVEFTGVGEPPAGAENVGYCTQIGIFRKNGGKATESCLS |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HENMT1 pAb (ATL-HPA028497 w/enhanced validation) | |
Datasheet | Anti HENMT1 pAb (ATL-HPA028497 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HENMT1 pAb (ATL-HPA028497 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HENMT1 pAb (ATL-HPA028497 w/enhanced validation) | |
Datasheet | Anti HENMT1 pAb (ATL-HPA028497 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HENMT1 pAb (ATL-HPA028497 w/enhanced validation) |