Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028464-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: HEN1 methyltransferase homolog 1 (Arabidopsis)
Gene Name: HENMT1
Alternative Gene Name: C1orf59, FLJ30525, HEN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045662: 68%, ENSRNOG00000042814: 47%
Entrez Gene ID: 113802
Uniprot ID: Q5T8I9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV
Gene Sequence MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV
Gene ID - Mouse ENSMUSG00000045662
Gene ID - Rat ENSRNOG00000042814
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation)
Datasheet Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation)
Datasheet Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation)
Citations for Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) – 1 Found
Liang, Hongwei; Jiao, Zichen; Rong, Weiwei; Qu, Shuang; Liao, Zhicong; Sun, Xinlei; Wei, Yao; Zhao, Quan; Wang, Jun; Liu, Yuan; Chen, Xi; Wang, Tao; Zhang, Chen-Yu; Zen, Ke. 3'-Terminal 2'-O-methylation of lung cancer miR-21-5p enhances its stability and association with Argonaute 2. Nucleic Acids Research. 2020;48(13):7027-7040.  PubMed