Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028464-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HENMT1
Alternative Gene Name: C1orf59, FLJ30525, HEN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045662: 68%, ENSRNOG00000042814: 47%
Entrez Gene ID: 113802
Uniprot ID: Q5T8I9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV |
| Gene Sequence | MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV |
| Gene ID - Mouse | ENSMUSG00000045662 |
| Gene ID - Rat | ENSRNOG00000042814 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) | |
| Datasheet | Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) | |
| Datasheet | Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) |
| Citations for Anti HENMT1 pAb (ATL-HPA028464 w/enhanced validation) – 1 Found |
| Liang, Hongwei; Jiao, Zichen; Rong, Weiwei; Qu, Shuang; Liao, Zhicong; Sun, Xinlei; Wei, Yao; Zhao, Quan; Wang, Jun; Liu, Yuan; Chen, Xi; Wang, Tao; Zhang, Chen-Yu; Zen, Ke. 3'-Terminal 2'-O-methylation of lung cancer miR-21-5p enhances its stability and association with Argonaute 2. Nucleic Acids Research. 2020;48(13):7027-7040. PubMed |