Anti HEMK1 pAb (ATL-HPA034701)

Atlas Antibodies

Catalog No.:
ATL-HPA034701-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HemK methyltransferase family member 1
Gene Name: HEMK1
Alternative Gene Name: MTQ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032579: 87%, ENSRNOG00000015458: 81%
Entrez Gene ID: 51409
Uniprot ID: Q9Y5R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QYILGEWDFQGLSLRMVPPVFIPRPETEELVEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHE
Gene Sequence QYILGEWDFQGLSLRMVPPVFIPRPETEELVEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHE
Gene ID - Mouse ENSMUSG00000032579
Gene ID - Rat ENSRNOG00000015458
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HEMK1 pAb (ATL-HPA034701)
Datasheet Anti HEMK1 pAb (ATL-HPA034701) Datasheet (External Link)
Vendor Page Anti HEMK1 pAb (ATL-HPA034701) at Atlas Antibodies

Documents & Links for Anti HEMK1 pAb (ATL-HPA034701)
Datasheet Anti HEMK1 pAb (ATL-HPA034701) Datasheet (External Link)
Vendor Page Anti HEMK1 pAb (ATL-HPA034701)