Anti HEMK1 pAb (ATL-HPA034701)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034701-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HEMK1
Alternative Gene Name: MTQ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032579: 87%, ENSRNOG00000015458: 81%
Entrez Gene ID: 51409
Uniprot ID: Q9Y5R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QYILGEWDFQGLSLRMVPPVFIPRPETEELVEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHE |
| Gene Sequence | QYILGEWDFQGLSLRMVPPVFIPRPETEELVEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHE |
| Gene ID - Mouse | ENSMUSG00000032579 |
| Gene ID - Rat | ENSRNOG00000015458 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HEMK1 pAb (ATL-HPA034701) | |
| Datasheet | Anti HEMK1 pAb (ATL-HPA034701) Datasheet (External Link) |
| Vendor Page | Anti HEMK1 pAb (ATL-HPA034701) at Atlas Antibodies |
| Documents & Links for Anti HEMK1 pAb (ATL-HPA034701) | |
| Datasheet | Anti HEMK1 pAb (ATL-HPA034701) Datasheet (External Link) |
| Vendor Page | Anti HEMK1 pAb (ATL-HPA034701) |