Anti HELQ pAb (ATL-HPA036853)
Atlas Antibodies
- SKU:
- ATL-HPA036853-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HELQ
Alternative Gene Name: Hel308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035266: 46%, ENSRNOG00000002181: 47%
Entrez Gene ID: 113510
Uniprot ID: Q8TDG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ECLVLGGGDTNPDLLRHMPTDRGVGDQPNDSEVDMFGDYDSFTENSFIAQVDDLEQKYMQLPEHKKHATDFATENLCSE |
Gene Sequence | ECLVLGGGDTNPDLLRHMPTDRGVGDQPNDSEVDMFGDYDSFTENSFIAQVDDLEQKYMQLPEHKKHATDFATENLCSE |
Gene ID - Mouse | ENSMUSG00000035266 |
Gene ID - Rat | ENSRNOG00000002181 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HELQ pAb (ATL-HPA036853) | |
Datasheet | Anti HELQ pAb (ATL-HPA036853) Datasheet (External Link) |
Vendor Page | Anti HELQ pAb (ATL-HPA036853) at Atlas Antibodies |
Documents & Links for Anti HELQ pAb (ATL-HPA036853) | |
Datasheet | Anti HELQ pAb (ATL-HPA036853) Datasheet (External Link) |
Vendor Page | Anti HELQ pAb (ATL-HPA036853) |