Anti HELQ pAb (ATL-HPA036853)

Atlas Antibodies

Catalog No.:
ATL-HPA036853-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: helicase, POLQ-like
Gene Name: HELQ
Alternative Gene Name: Hel308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035266: 46%, ENSRNOG00000002181: 47%
Entrez Gene ID: 113510
Uniprot ID: Q8TDG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECLVLGGGDTNPDLLRHMPTDRGVGDQPNDSEVDMFGDYDSFTENSFIAQVDDLEQKYMQLPEHKKHATDFATENLCSE
Gene Sequence ECLVLGGGDTNPDLLRHMPTDRGVGDQPNDSEVDMFGDYDSFTENSFIAQVDDLEQKYMQLPEHKKHATDFATENLCSE
Gene ID - Mouse ENSMUSG00000035266
Gene ID - Rat ENSRNOG00000002181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HELQ pAb (ATL-HPA036853)
Datasheet Anti HELQ pAb (ATL-HPA036853) Datasheet (External Link)
Vendor Page Anti HELQ pAb (ATL-HPA036853) at Atlas Antibodies

Documents & Links for Anti HELQ pAb (ATL-HPA036853)
Datasheet Anti HELQ pAb (ATL-HPA036853) Datasheet (External Link)
Vendor Page Anti HELQ pAb (ATL-HPA036853)