Anti HECA pAb (ATL-HPA042313)

Atlas Antibodies

SKU:
ATL-HPA042313-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells .
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: headcase homolog (Drosophila)
Gene Name: HECA
Alternative Gene Name: dJ225E12.1, HDC, HDCL, hHDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039879: 97%, ENSRNOG00000060972: 97%
Entrez Gene ID: 51696
Uniprot ID: Q9UBI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSSRYLGEFLKNAIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVP
Gene Sequence RSSRYLGEFLKNAIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVP
Gene ID - Mouse ENSMUSG00000039879
Gene ID - Rat ENSRNOG00000060972
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HECA pAb (ATL-HPA042313)
Datasheet Anti HECA pAb (ATL-HPA042313) Datasheet (External Link)
Vendor Page Anti HECA pAb (ATL-HPA042313) at Atlas Antibodies

Documents & Links for Anti HECA pAb (ATL-HPA042313)
Datasheet Anti HECA pAb (ATL-HPA042313) Datasheet (External Link)
Vendor Page Anti HECA pAb (ATL-HPA042313)