Anti HECA pAb (ATL-HPA012581)

Atlas Antibodies

SKU:
ATL-HPA012581-25
  • Immunofluorescent staining of human cell line RT4 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: hdc homolog, cell cycle regulator
Gene Name: HECA
Alternative Gene Name: dJ225E12.1, HDC, HDCL, hHDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039879: 97%, ENSRNOG00000060972: 97%
Entrez Gene ID: 51696
Uniprot ID: Q9UBI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSSRYLGEFLKNAIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVP
Gene Sequence RSSRYLGEFLKNAIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVP
Gene ID - Mouse ENSMUSG00000039879
Gene ID - Rat ENSRNOG00000060972
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HECA pAb (ATL-HPA012581)
Datasheet Anti HECA pAb (ATL-HPA012581) Datasheet (External Link)
Vendor Page Anti HECA pAb (ATL-HPA012581) at Atlas Antibodies

Documents & Links for Anti HECA pAb (ATL-HPA012581)
Datasheet Anti HECA pAb (ATL-HPA012581) Datasheet (External Link)
Vendor Page Anti HECA pAb (ATL-HPA012581)