Anti HEATR9 pAb (ATL-HPA023129)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023129-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HEATR9
Alternative Gene Name: C17orf66, FLJ32830
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018925: 58%, ENSRNOG00000037100: 57%
Entrez Gene ID: 256957
Uniprot ID: A2RTY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NKVLSVYEAPKTNVKAEPTRFQKEPENPEELTIQDFRLAKLNPLFIAKSITKVGQKKTPAFPPCCSKPRKHRPQVIGPWQPRIKKQL |
| Gene Sequence | NKVLSVYEAPKTNVKAEPTRFQKEPENPEELTIQDFRLAKLNPLFIAKSITKVGQKKTPAFPPCCSKPRKHRPQVIGPWQPRIKKQL |
| Gene ID - Mouse | ENSMUSG00000018925 |
| Gene ID - Rat | ENSRNOG00000037100 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HEATR9 pAb (ATL-HPA023129) | |
| Datasheet | Anti HEATR9 pAb (ATL-HPA023129) Datasheet (External Link) |
| Vendor Page | Anti HEATR9 pAb (ATL-HPA023129) at Atlas Antibodies |
| Documents & Links for Anti HEATR9 pAb (ATL-HPA023129) | |
| Datasheet | Anti HEATR9 pAb (ATL-HPA023129) Datasheet (External Link) |
| Vendor Page | Anti HEATR9 pAb (ATL-HPA023129) |