Anti HEATR5B pAb (ATL-HPA042025)

Atlas Antibodies

SKU:
ATL-HPA042025-25
  • Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HEAT repeat containing 5B
Gene Name: HEATR5B
Alternative Gene Name: DKFZp686P15184, KIAA1414
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039414: 89%, ENSRNOG00000025926: 89%
Entrez Gene ID: 54497
Uniprot ID: Q9P2D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPPPVSAALQGIKSIVTLSMAKTEAGVQKQWTALIRSTLACILEYSQPEDSVPTPDEVSMLTAIALFLWSASNEIIGVQSLQNGCMNRF
Gene Sequence VPPPVSAALQGIKSIVTLSMAKTEAGVQKQWTALIRSTLACILEYSQPEDSVPTPDEVSMLTAIALFLWSASNEIIGVQSLQNGCMNRF
Gene ID - Mouse ENSMUSG00000039414
Gene ID - Rat ENSRNOG00000025926
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HEATR5B pAb (ATL-HPA042025)
Datasheet Anti HEATR5B pAb (ATL-HPA042025) Datasheet (External Link)
Vendor Page Anti HEATR5B pAb (ATL-HPA042025) at Atlas Antibodies

Documents & Links for Anti HEATR5B pAb (ATL-HPA042025)
Datasheet Anti HEATR5B pAb (ATL-HPA042025) Datasheet (External Link)
Vendor Page Anti HEATR5B pAb (ATL-HPA042025)