Anti HEATR1 pAb (ATL-HPA046917)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046917-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HEATR1
Alternative Gene Name: BAP28, FLJ10359, UTP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050244: 82%, ENSRNOG00000047594: 81%
Entrez Gene ID: 55127
Uniprot ID: Q9H583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QELFHQFVSLSTSGGKYQFLADSDTSLMLSLNHPLAPVRILAMNHLKKIMKTSKEGVDESFIKEAVLARLGDDNIDVVLSAISAFEIFKEHFS |
| Gene Sequence | QELFHQFVSLSTSGGKYQFLADSDTSLMLSLNHPLAPVRILAMNHLKKIMKTSKEGVDESFIKEAVLARLGDDNIDVVLSAISAFEIFKEHFS |
| Gene ID - Mouse | ENSMUSG00000050244 |
| Gene ID - Rat | ENSRNOG00000047594 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HEATR1 pAb (ATL-HPA046917) | |
| Datasheet | Anti HEATR1 pAb (ATL-HPA046917) Datasheet (External Link) |
| Vendor Page | Anti HEATR1 pAb (ATL-HPA046917) at Atlas Antibodies |
| Documents & Links for Anti HEATR1 pAb (ATL-HPA046917) | |
| Datasheet | Anti HEATR1 pAb (ATL-HPA046917) Datasheet (External Link) |
| Vendor Page | Anti HEATR1 pAb (ATL-HPA046917) |
| Citations for Anti HEATR1 pAb (ATL-HPA046917) – 1 Found |
| Turi, Zsofia; Senkyrikova, Marketa; Mistrik, Martin; Bartek, Jiri; Moudry, Pavel. Perturbation of RNA Polymerase I transcription machinery by ablation of HEATR1 triggers the RPL5/RPL11-MDM2-p53 ribosome biogenesis stress checkpoint pathway in human cells. Cell Cycle (Georgetown, Tex.). 17(1):92-101. PubMed |