Anti HDLBP pAb (ATL-HPA004189)

Atlas Antibodies

SKU: ATL-HPA004189-25

• 
• 

Protein Description: high density lipoprotein binding protein
Gene Name: HDLBP
Alternative Gene Name: HBP, VGL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034088: 99%, ENSRNOG00000031479: 99%
Entrez Gene ID: 3069
Uniprot ID: Q00341
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVE
• Gene Sequence: DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVE
• Gene ID - Mouse: ENSMUSG00000034088
• Gene ID - Rat: ENSRNOG00000031479
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.