Anti HDHD5 pAb (ATL-HPA005548)

Atlas Antibodies

SKU:
ATL-HPA005548-25
  • Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: haloacid dehalogenase like hydrolase domain containing 5
Gene Name: HDHD5
Alternative Gene Name: CECR5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058979: 75%, ENSRNOG00000011338: 72%
Entrez Gene ID: 27440
Uniprot ID: Q9BXW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTFLLCLETIYQKVTGKELRYEGLMGKPSILTYQYAEDLIRRQAERRGWAAPIRKLYAVGDNPMSDVYGANLFHQYLQKATHDGAPELGAGGTRQQQPSASQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASHVVNDVNEAVQLVFRKEG
Gene Sequence GTFLLCLETIYQKVTGKELRYEGLMGKPSILTYQYAEDLIRRQAERRGWAAPIRKLYAVGDNPMSDVYGANLFHQYLQKATHDGAPELGAGGTRQQQPSASQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASHVVNDVNEAVQLVFRKEG
Gene ID - Mouse ENSMUSG00000058979
Gene ID - Rat ENSRNOG00000011338
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HDHD5 pAb (ATL-HPA005548)
Datasheet Anti HDHD5 pAb (ATL-HPA005548) Datasheet (External Link)
Vendor Page Anti HDHD5 pAb (ATL-HPA005548) at Atlas Antibodies

Documents & Links for Anti HDHD5 pAb (ATL-HPA005548)
Datasheet Anti HDHD5 pAb (ATL-HPA005548) Datasheet (External Link)
Vendor Page Anti HDHD5 pAb (ATL-HPA005548)