Anti HDHD3 pAb (ATL-HPA024585 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024585-25
  • Immunohistochemical staining of human colon, liver, lymph node and parathyroid gland using Anti-HDHD3 antibody HPA024585 (A) shows similar protein distribution across tissues to independent antibody HPA024158 (B).
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: haloacid dehalogenase-like hydrolase domain containing 3
Gene Name: HDHD3
Alternative Gene Name: C9orf158, MGC12904
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038422: 78%, ENSRNOG00000015195: 78%
Entrez Gene ID: 81932
Uniprot ID: Q9BSH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVV
Gene Sequence MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVV
Gene ID - Mouse ENSMUSG00000038422
Gene ID - Rat ENSRNOG00000015195
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HDHD3 pAb (ATL-HPA024585 w/enhanced validation)
Datasheet Anti HDHD3 pAb (ATL-HPA024585 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HDHD3 pAb (ATL-HPA024585 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HDHD3 pAb (ATL-HPA024585 w/enhanced validation)
Datasheet Anti HDHD3 pAb (ATL-HPA024585 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HDHD3 pAb (ATL-HPA024585 w/enhanced validation)