Anti HDHD3 pAb (ATL-HPA024158 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024158-25
  • Immunohistochemical staining of human colon, liver, lymph node and parathyroid gland using Anti-HDHD3 antibody HPA024158 (A) shows similar protein distribution across tissues to independent antibody HPA024585 (B).
  • Western blot analysis in control (vector only transfected HEK293T lysate) and HDHD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410593).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: haloacid dehalogenase-like hydrolase domain containing 3
Gene Name: HDHD3
Alternative Gene Name: C9orf158, MGC12904
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038422: 76%, ENSRNOG00000015195: 73%
Entrez Gene ID: 81932
Uniprot ID: Q9BSH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGW
Gene Sequence LQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGW
Gene ID - Mouse ENSMUSG00000038422
Gene ID - Rat ENSRNOG00000015195
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HDHD3 pAb (ATL-HPA024158 w/enhanced validation)
Datasheet Anti HDHD3 pAb (ATL-HPA024158 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HDHD3 pAb (ATL-HPA024158 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HDHD3 pAb (ATL-HPA024158 w/enhanced validation)
Datasheet Anti HDHD3 pAb (ATL-HPA024158 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HDHD3 pAb (ATL-HPA024158 w/enhanced validation)



Citations for Anti HDHD3 pAb (ATL-HPA024158 w/enhanced validation) – 1 Found
Inoue, A; Okamoto, K; Fujino, Y; Nakagawa, T; Muguruma, N; Sannomiya, K; Mitsui, Y; Takaoka, T; Kitamura, S; Miyamoto, H; Okahisa, T; Fujimori, T; Imoto, I; Takayama, T. B-RAF mutation and accumulated gene methylation in aberrant crypt foci (ACF), sessile serrated adenoma/polyp (SSA/P) and cancer in SSA/P. British Journal Of Cancer. 2015;112(2):403-12.  PubMed