Anti HDDC3 pAb (ATL-HPA040895)

Atlas Antibodies

Catalog No.:
ATL-HPA040895-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: HD domain containing 3
Gene Name: HDDC3
Alternative Gene Name: MGC45386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030532: 93%, ENSRNOG00000012236: 91%
Entrez Gene ID: 374659
Uniprot ID: Q8N4P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEGWSEHRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQR
Gene Sequence PKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEGWSEHRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQR
Gene ID - Mouse ENSMUSG00000030532
Gene ID - Rat ENSRNOG00000012236
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HDDC3 pAb (ATL-HPA040895)
Datasheet Anti HDDC3 pAb (ATL-HPA040895) Datasheet (External Link)
Vendor Page Anti HDDC3 pAb (ATL-HPA040895) at Atlas Antibodies

Documents & Links for Anti HDDC3 pAb (ATL-HPA040895)
Datasheet Anti HDDC3 pAb (ATL-HPA040895) Datasheet (External Link)
Vendor Page Anti HDDC3 pAb (ATL-HPA040895)