Anti HDAC6 pAb (ATL-HPA026321)

Atlas Antibodies

SKU:
ATL-HPA026321-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: histone deacetylase 6
Gene Name: HDAC6
Alternative Gene Name: FLJ16239, HD6, JM21, KIAA0901, PPP1R90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031161: 47%, ENSRNOG00000047281: 49%
Entrez Gene ID: 10013
Uniprot ID: Q9UBN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
Gene Sequence QVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
Gene ID - Mouse ENSMUSG00000031161
Gene ID - Rat ENSRNOG00000047281
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HDAC6 pAb (ATL-HPA026321)
Datasheet Anti HDAC6 pAb (ATL-HPA026321) Datasheet (External Link)
Vendor Page Anti HDAC6 pAb (ATL-HPA026321) at Atlas Antibodies

Documents & Links for Anti HDAC6 pAb (ATL-HPA026321)
Datasheet Anti HDAC6 pAb (ATL-HPA026321) Datasheet (External Link)
Vendor Page Anti HDAC6 pAb (ATL-HPA026321)