Anti HCRTR2 pAb (ATL-HPA054516)
Atlas Antibodies
- SKU:
- ATL-HPA054516-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HCRTR2
Alternative Gene Name: OX2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032360: 86%, ENSRNOG00000011251: 86%
Entrez Gene ID: 3062
Uniprot ID: O43614
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRK |
Gene Sequence | WCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRK |
Gene ID - Mouse | ENSMUSG00000032360 |
Gene ID - Rat | ENSRNOG00000011251 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HCRTR2 pAb (ATL-HPA054516) | |
Datasheet | Anti HCRTR2 pAb (ATL-HPA054516) Datasheet (External Link) |
Vendor Page | Anti HCRTR2 pAb (ATL-HPA054516) at Atlas Antibodies |
Documents & Links for Anti HCRTR2 pAb (ATL-HPA054516) | |
Datasheet | Anti HCRTR2 pAb (ATL-HPA054516) Datasheet (External Link) |
Vendor Page | Anti HCRTR2 pAb (ATL-HPA054516) |