Anti HCRTR1 pAb (ATL-HPA014018)

Atlas Antibodies

Catalog No.: ATL-HPA014018-25

Protein Description: hypocretin (orexin) receptor 1
Gene Name: HCRTR1
Alternative Gene Name: OX1R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028778: 85%, ENSRNOG00000013838: 85%
Entrez Gene ID: 3061
Uniprot ID: O43613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV
• Gene Sequence: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV
• Gene ID - Mouse: ENSMUSG00000028778
• Gene ID - Rat: ENSRNOG00000013838
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HCRTR1 pAb (ATL-HPA014018) – 1 Found

Schwenk, Jochen M; Igel, Ulrika; Neiman, Maja; Langen, Hanno; Becker, Charlotte; Bjartell, Anders; Ponten, Fredrik; Wiklund, Fredrik; Grönberg, Henrik; Nilsson, Peter; Uhlen, Mathias. Toward next generation plasma profiling via heat-induced epitope retrieval and array-based assays. Molecular & Cellular Proteomics : Mcp. 2010;9(11):2497-507.