Anti HCRTR1 pAb (ATL-HPA014018)
Atlas Antibodies
- SKU:
- ATL-HPA014018-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HCRTR1
Alternative Gene Name: OX1R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028778: 85%, ENSRNOG00000013838: 85%
Entrez Gene ID: 3061
Uniprot ID: O43613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV |
Gene Sequence | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV |
Gene ID - Mouse | ENSMUSG00000028778 |
Gene ID - Rat | ENSRNOG00000013838 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HCRTR1 pAb (ATL-HPA014018) | |
Datasheet | Anti HCRTR1 pAb (ATL-HPA014018) Datasheet (External Link) |
Vendor Page | Anti HCRTR1 pAb (ATL-HPA014018) at Atlas Antibodies |
Documents & Links for Anti HCRTR1 pAb (ATL-HPA014018) | |
Datasheet | Anti HCRTR1 pAb (ATL-HPA014018) Datasheet (External Link) |
Vendor Page | Anti HCRTR1 pAb (ATL-HPA014018) |
Citations for Anti HCRTR1 pAb (ATL-HPA014018) – 1 Found |
Schwenk, Jochen M; Igel, Ulrika; Neiman, Maja; Langen, Hanno; Becker, Charlotte; Bjartell, Anders; Ponten, Fredrik; Wiklund, Fredrik; Grönberg, Henrik; Nilsson, Peter; Uhlen, Mathias. Toward next generation plasma profiling via heat-induced epitope retrieval and array-based assays. Molecular & Cellular Proteomics : Mcp. 2010;9(11):2497-507. PubMed |