Anti HCRTR1 pAb (ATL-HPA014018)

Atlas Antibodies

Catalog No.:
ATL-HPA014018-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: hypocretin (orexin) receptor 1
Gene Name: HCRTR1
Alternative Gene Name: OX1R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028778: 85%, ENSRNOG00000013838: 85%
Entrez Gene ID: 3061
Uniprot ID: O43613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV
Gene Sequence MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV
Gene ID - Mouse ENSMUSG00000028778
Gene ID - Rat ENSRNOG00000013838
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HCRTR1 pAb (ATL-HPA014018)
Datasheet Anti HCRTR1 pAb (ATL-HPA014018) Datasheet (External Link)
Vendor Page Anti HCRTR1 pAb (ATL-HPA014018) at Atlas Antibodies

Documents & Links for Anti HCRTR1 pAb (ATL-HPA014018)
Datasheet Anti HCRTR1 pAb (ATL-HPA014018) Datasheet (External Link)
Vendor Page Anti HCRTR1 pAb (ATL-HPA014018)
Citations for Anti HCRTR1 pAb (ATL-HPA014018) – 1 Found
Schwenk, Jochen M; Igel, Ulrika; Neiman, Maja; Langen, Hanno; Becker, Charlotte; Bjartell, Anders; Ponten, Fredrik; Wiklund, Fredrik; Grönberg, Henrik; Nilsson, Peter; Uhlen, Mathias. Toward next generation plasma profiling via heat-induced epitope retrieval and array-based assays. Molecular & Cellular Proteomics : Mcp. 2010;9(11):2497-507.  PubMed