Anti HCLS1 pAb (ATL-HPA019143)

Atlas Antibodies

SKU: ATL-HPA019143-25

• 

Protein Description: hematopoietic cell-specific Lyn substrate 1
Gene Name: HCLS1
Alternative Gene Name: CTTNL, HS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022831: 75%, ENSRNOG00000038881: 75%
Entrez Gene ID: 3059
Uniprot ID: P14317
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSRE
• Gene Sequence: PTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSRE
• Gene ID - Mouse: ENSMUSG00000022831
• Gene ID - Rat: ENSRNOG00000038881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.