Anti HCCS pAb (ATL-HPA002946)

Atlas Antibodies

Catalog No.:
ATL-HPA002946-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: holocytochrome c synthase
Gene Name: HCCS
Alternative Gene Name: CCHL, MLS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031352: 90%, ENSRNOG00000025910: 92%
Entrez Gene ID: 3052
Uniprot ID: P53701
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYEL
Gene Sequence YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYEL
Gene ID - Mouse ENSMUSG00000031352
Gene ID - Rat ENSRNOG00000025910
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HCCS pAb (ATL-HPA002946)
Datasheet Anti HCCS pAb (ATL-HPA002946) Datasheet (External Link)
Vendor Page Anti HCCS pAb (ATL-HPA002946) at Atlas Antibodies

Documents & Links for Anti HCCS pAb (ATL-HPA002946)
Datasheet Anti HCCS pAb (ATL-HPA002946) Datasheet (External Link)
Vendor Page Anti HCCS pAb (ATL-HPA002946)
Citations for Anti HCCS pAb (ATL-HPA002946) – 2 Found
Thinon, Emmanuelle; Serwa, Remigiusz A; Broncel, Malgorzata; Brannigan, James A; Brassat, Ute; Wright, Megan H; Heal, William P; Wilkinson, Anthony J; Mann, David J; Tate, Edward W. Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nature Communications. 2014;5( 25255805):4919.  PubMed
Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.  PubMed