Anti HCCS pAb (ATL-HPA002946)

Atlas Antibodies

SKU: ATL-HPA002946-25

• 
• 
• 

Protein Description: holocytochrome c synthase
Gene Name: HCCS
Alternative Gene Name: CCHL, MLS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031352: 90%, ENSRNOG00000025910: 92%
Entrez Gene ID: 3052
Uniprot ID: P53701
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYEL
• Gene Sequence: YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYEL
• Gene ID - Mouse: ENSMUSG00000031352
• Gene ID - Rat: ENSRNOG00000025910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HCCS pAb (ATL-HPA002946) – 2 Found

Thinon, Emmanuelle; Serwa, Remigiusz A; Broncel, Malgorzata; Brannigan, James A; Brassat, Ute; Wright, Megan H; Heal, William P; Wilkinson, Anthony J; Mann, David J; Tate, Edward W. Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nature Communications. 2014;5( 25255805):4919. 

Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.