Anti HCCS pAb (ATL-HPA002946)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002946-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HCCS
Alternative Gene Name: CCHL, MLS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031352: 90%, ENSRNOG00000025910: 92%
Entrez Gene ID: 3052
Uniprot ID: P53701
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYEL |
| Gene Sequence | YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYEL |
| Gene ID - Mouse | ENSMUSG00000031352 |
| Gene ID - Rat | ENSRNOG00000025910 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HCCS pAb (ATL-HPA002946) | |
| Datasheet | Anti HCCS pAb (ATL-HPA002946) Datasheet (External Link) |
| Vendor Page | Anti HCCS pAb (ATL-HPA002946) at Atlas Antibodies |
| Documents & Links for Anti HCCS pAb (ATL-HPA002946) | |
| Datasheet | Anti HCCS pAb (ATL-HPA002946) Datasheet (External Link) |
| Vendor Page | Anti HCCS pAb (ATL-HPA002946) |
| Citations for Anti HCCS pAb (ATL-HPA002946) – 2 Found |
| Thinon, Emmanuelle; Serwa, Remigiusz A; Broncel, Malgorzata; Brannigan, James A; Brassat, Ute; Wright, Megan H; Heal, William P; Wilkinson, Anthony J; Mann, David J; Tate, Edward W. Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nature Communications. 2014;5( 25255805):4919. PubMed |
| Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614. PubMed |