Anti HBS1L pAb (ATL-HPA029729 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029729-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: HBS1-like translational GTPase
Gene Name: HBS1L
Alternative Gene Name: DKFZp434g247, EF-1a, eRF3c, ERFS, HBS1, HSPC276, KIAA1038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019977: 86%, ENSRNOG00000014531: 88%
Entrez Gene ID: 10767
Uniprot ID: Q9Y450
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEI
Gene Sequence RNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEI
Gene ID - Mouse ENSMUSG00000019977
Gene ID - Rat ENSRNOG00000014531
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HBS1L pAb (ATL-HPA029729 w/enhanced validation)
Datasheet Anti HBS1L pAb (ATL-HPA029729 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HBS1L pAb (ATL-HPA029729 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HBS1L pAb (ATL-HPA029729 w/enhanced validation)
Datasheet Anti HBS1L pAb (ATL-HPA029729 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HBS1L pAb (ATL-HPA029729 w/enhanced validation)
Citations for Anti HBS1L pAb (ATL-HPA029729 w/enhanced validation) – 3 Found
Kalisiak, Katarzyna; Kuliński, Tomasz M; Tomecki, Rafał; Cysewski, Dominik; Pietras, Zbigniew; Chlebowski, Aleksander; Kowalska, Katarzyna; Dziembowski, Andrzej. A short splicing isoform of HBS1L links the cytoplasmic exosome and SKI complexes in humans. Nucleic Acids Research. 2017;45(4):2068-2080.  PubMed
Hojka-Osinska, Anna; Chlebowski, Aleksander; Grochowska, Joanna; Owczarek, Ewelina P; Affek, Kamila; Kłosowska-Kosicka, Kamila; Szczesny, Roman J; Dziembowski, Andrzej. Landscape of functional interactions of human processive ribonucleases revealed by high-throughput siRNA screenings. Iscience. 2021;24(9):103036.  PubMed
Ahmad, Yasmeen; Boisvert, Francois-Michel; Lundberg, Emma; Uhlen, Mathias; Lamond, Angus I. Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013680.  PubMed